Recombinant Human UbE2G2
ScienCell’s Recombinant Human UbE2G2 (6xHis-UbE2G2) is for research use only. It is not approved for human or animal use, or for application in clinical or in vitro diagnostic procedures.
Recombinant Human UbE2G2 is a member of the Ubiquitin-conjugating (E2) enzyme family that acquires Ubiquitin from a Ubiquitin-activating (E1) enzyme and subsequently reacts with a Ubiquitin ligase (E3) to conjugate Ubiquitin to substrate proteins. UbE2G2 is known for its role in endoplasmic reticulum-associated degradation (ERAD) by interacting with the E3 ligase called GP78 to catalyze K48 – linked Ub chains. Furthermore, UbE2G2 also plays a role in the innate immune response (in regulating STING signaling).
| Catalog No. | MB7428 |
|---|---|
| Country of Manufacture | United States |
| Product Code | 6xHis-UbE2G2 |
| Size/Quantity | 25 ug or 100 ug |
| Product use | This product is for research use only. It is not approved for human or animal use, or for application in in vitro diagnostic procedures. |
| Storage | Upon receipt, store at -20°C in a manual defrost freezer. |
| Shipping | Dry ice. |
| Synonyms | UBC7, Ubiquitin Carrier Protein G2; Ubiquitin-Protein Ligase G2 |
| AA Sequence | MGSSHHHHHHSSGLVPRGSHMMAGTAL KRLMAEYKQLTLNPPEGIVAGPMNEENF FEWEALIMGPEDTCFEFGVFPAILSFPLDY PLSPPKMRFTCEMFHPNIYPDGRVCISILH APGDDPMGYESSAERWSPVQSVEKILLSV VSMLAEPNDESGANVDASKMWRDDREQ FYKIAKQIVQKSLGL |
| Source | Escherichia coli |
| Molecular Weight | 20.8 kDa |
| Purity | > 95% |
No Publication available at this time.
Related Products
Check items to add to the cart or
