Recombinant Human UbE2D3
Recombinant Human UbE2D3 is a member of the Ubiquitin-conjugating (E2) enzyme family that acquires Ubiquitin from a Ubiquitin-activating (E1) enzyme and subsequently reacts with a Ubiquitin ligase (E3) to conjugate Ubiquitin to substrate proteins. Human UbE2D3 shares 88% and 89% amino acid sequence identity with UbE2D1 and UbE2D2, the close related family members. Human UbE2D3 works with a number of E3 enzymes, including MDM2 and CHIP, making it suitable for studying E3 ligase mechanisms, targeted protein degradation, and ubiquitin-dependent disease pathways.
| Catalog No. | MB7358 |
|---|---|
| Country of Manufacture | United States |
| Product Code | 6xHis-UbE2D3 |
| Size/Quantity | 25 ug or 100 ug |
| Product use | This product is for research use only. It is not approved for human or animal use, or for application in in vitro diagnostic procedures. |
| Storage | Upon receipt, store at -20°C in a manual defrost freezer. |
| Shipping | Dry ice. |
| Synonyms | UBC4/5, UBCH5C, E2(17)KB3 |
| AA Sequence | MGSSHHHHHHSSGLVPRGSHMMALKRINK ELSDLARDPPAQCSAGPVGDDMFHWQATI MGPNDSPYQGGVFFLTIHFPTDYPFKPPKV AFTTRIYHPNINSNGSICLDILRSQWSPALTI SKVLLSICSLLCDPNPDDPLVPEIARIYKTDR DKYNRISREWTQKYAM |
| Source | Escherichia coli |
| Molecular Weight | 18.9 kDa |
| Purity | > 95% |
No Publication available at this time.